PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC050635.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family GeBP
Protein Properties Length: 261aa    MW: 29513.5 Da    PI: 9.7489
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC050635.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57397.41.4e-3049143297
        DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                   +fq++w ++Dei+lLqG+id+  ++g++p+++++afy+ vk+ +  + + sql +K+  +KkK+++++ k k g++ +fs++h+ kifelskkiW+
  EcC050635.10  49 AFQKIWRDDDEITLLQGIIDY-REKGMNPFSNVSAFYHDVKGLLREDLTVSQLANKVWVFKKKYRNNRGKGKVGEDRVFSNSHEGKIFELSKKIWD 143
                   59*******************.789**********************************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.9E-2650143IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
QGSSSARSGY EHEKKAPSLK KSKTVPSTSL KQVEVDKLGH AGKESKKLAF QKIWRDDDEI  60
TLLQGIIDYR EKGMNPFSNV SAFYHDVKGL LREDLTVSQL ANKVWVFKKK YRNNRGKGKV  120
GEDRVFSNSH EGKIFELSKK IWDVEMRGNA TSSREEIGVT KNKKTDGVGM FVASPQSKSE  180
ASKSNDLQEH LDNISQMCRV GLDEGSLNQG LALLEPSKRA ELKERWSKLF FVEMQTVAER  240
CTLIEDQLKL ILEAYSHSTE K
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010039902.10.0PREDICTED: mediator-associated protein 1-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25210.17e-18DNA-binding storekeeper protein-related transcriptional regulator